- ZFAND3 Antibody
- Novus Biologicals, a Bio-Techne Brand
- Pricing InfoSupplier PageView Company Product Page
- NBP1-82262
- ZFAND3
- TEX27
- Rabbit
- 0.1 ml (also 25ul)
- Unconjugated
- Immunocytochemistry/ Immunofluorescence
- This antibody was developed against Recombinant Protein corresponding to amino acids: MGDAGSERSK APSLPPRCPC GFWGSSKTMN LCSKCFADFQ KKQPDDDSAP STSNSQSDLF SEETTSDNNN TSITTPTLSP
- PBS (pH 7.2) and 40% Glycerol
- Human
- zinc finger AN1-type containing 3
- Novus Biologicals, a Bio-Techne Brand
- IgG
- Polyclonal
- Immunogen affinity purified
- Primary Antibodies
- Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles
- Signal Transduction
Sequence
MGDAGSERSKAPSLPPRCPCGFWGSSKTMNLCSKCFADFQKKQPDDDSAPSTSNSQSDLFSEETTSDNNNTSITTPTLSP
Specifications/Features
Available conjugates: Unconjugated